PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr7P14960_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family TALE
Protein Properties Length: 440aa    MW: 49079 Da    PI: 6.9405
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr7P14960_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox31.82.5e-102432801954
                            HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
               Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                            Fe   ++yp+  +++ LAk++gLt +qV++WF N R +
  GSMUA_Achr7P14960_001 243 FEHflHPYPTDVDKQNLAKQTGLTRNQVSNWFINARVR 280
                            554458******************************88 PP

2BELL100.61.2e-32110179372
                   BELL   3 qelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                            +e q kk+ L+s+l+eV++rYkqy++q+q+vi sFe vagl +a+pY+s+Alka+S+hFr+Lk+ i++q+
  GSMUA_Achr7P14960_001 110 TEQQWKKTMLISMLDEVYRRYKQYYQQVQAVITSFESVAGLSTAAPYASMALKAMSKHFRSLKNIISDQL 179
                            58899**************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005743.2E-1850177IPR006563POX domain
PfamPF075262.0E-30101176IPR006563POX domain
PROSITE profilePS5007112.341221284IPR001356Homeobox domain
SMARTSM003891.1E-10224288IPR001356Homeobox domain
CDDcd000865.77E-13224285No hitNo description
SuperFamilySSF466897.7E-17226291IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.9E-28227288IPR009057Homeodomain-like
PfamPF059201.5E-18241280IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 440 aa     Download sequence    Send to blast
MTSSAADRFM GGGEGGGGEE QLLLHHPQMY YHVPQHSRRE KLRFPAEEST PATSLLLLYG  60
PNNAPPLYPP NSLTAFHPSF SSSSDSLVDH GGDGLPDHGM KEDDRPITGT EQQWKKTMLI  120
SMLDEVYRRY KQYYQQVQAV ITSFESVAGL STAAPYASMA LKAMSKHFRS LKNIISDQLR  180
QTNKGLRNEG ISREEMSNFG LLDGSGYLHR TTNSTNTFAQ PHVWRPQRGL PERAVSVLRS  240
WLFEHFLHPY PTDVDKQNLA KQTGLTRNQV SNWFINARVR LWKPMVEEIH SLEMRQKNKM  300
SASDCDERQP PRPSSSKTSA FDPQPLQILS TQSHQYSMSK GIQEELTPMP NHIPEPVNFD  360
TSDHHIGGGV GVAAGGSGVS LTLGLHQNNG VCFSEPLPLD VARRFGLDEC SDTYLVGAFG  420
DQERQFGKDV GSRLLHDFVG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A3e-16230288563Homeobox protein Meis2
3k2a_B3e-16230288563Homeobox protein Meis2
4xrs_A2e-16230287158Homeobox protein Meis1
4xrs_B2e-16230287158Homeobox protein Meis1
5bng_A2e-16230288159Homeobox protein Meis2
5bng_B2e-16230288159Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2260340.0AC226034.1 Musa acuminata clone BAC MA4-18J6, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009409501.10.0PREDICTED: BEL1-like homeodomain protein 9
SwissprotQ9LZM82e-67BLH9_ARATH; BEL1-like homeodomain protein 9
TrEMBLM0THN30.0M0THN3_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr7P14960_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25283881
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.15e-57TALE family protein